PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0013s0271.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 411aa    MW: 46132.2 Da    PI: 4.4643
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0013s0271.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.38.2e-06352399754
                           --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           + ke + + e+++++++ ps +++e L + ++++ +++  WF  +R k
  Sphfalx0013s0271.1.p 352 LRKEHIATFERVYRQSKRPSNAMIENLVMLTHVPRQKILQWFDEQRSK 399
                           678999****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-6342400IPR009057Homeodomain-like
PROSITE profilePS500718.665343403IPR001356Homeobox domain
CDDcd000860.00549346399No hitNo description
Gene3DG3DSA:1.10.10.602.9E-5354399IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MAAATLIFST VSSTSCCWKA RCSSVVLPRS ACLQSSSCGF RCVRFPQSQI HLLKARRRPA  60
LACAARTGRR RQGSSSSKIK KKRIEEDDAA AEAALEALFL QLEKDLELDG ESGEAEDDDD  120
ITEEEMIAFE QELNAVLGLG EDDEDDGEGD DEAAEEGEVE SENGETGLLD MVMKDGIYGH  180
TTTSHPDEDQ KLKFASNGRL EVKEYSYDSY EDEDDDYDEE DEEEEEEQRT VKLEKWQLKK  240
LAVAVEKGRR RVNVKSLAAD VRMDRSDVLS FLRDPPLDLL VMSASLEDSD SSDDEDESAQ  300
ITNSRLAELT RTRRLAPTGL PDKRIPKLMK QATLAPGGGA GGPQSWQRNK RLRKEHIATF  360
ERVYRQSKRP SNAMIENLVM LTHVPRQKIL QWFDEQRSKN ETRPTFEDAL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16882RRRQGSSSSKIKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-28overexpressor of cationic peroxidase 3